PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 155aa    MW: 18302.2 Da    PI: 10.5207
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57782.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.13.1e-30959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krien++nrqvt+skRrng++KKA+EL vLCda+v++i++sst+kl+ey+s
  EPS57782.1  9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYIS 59
                79***********************************************86 PP

2K-box81.22.4e-2771154184
       K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                 yqk+ g++l+++++e+lq +l+kLk+ ++nL++e+R+++Ge+L++L ++e  +L ++++ slk iR++K+++l +qi++++kk 
  EPS57782.1  71 YQKTLGVDLWNTHYERLQDHLKKLKEGNRNLRKEIRQRMGECLNELGYEEVVNLIENIDASLKLIRERKYKVLANQIDTSKKKV 154
                 7899999***************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.441161IPR002100Transcription factor, MADS-box
CDDcd002659.89E-38280No hitNo description
PRINTSPR004043.8E-28323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-36395IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-1682154IPR002487Transcription factor, K-box
PROSITE profilePS5129713.32584155IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD AKVSIIMISS TQKLHEYISP  60
STTTKQVFDL YQKTLGVDLW NTHYERLQDH LKKLKEGNRN LRKEIRQRMG ECLNELGYEE  120
VVNLIENIDA SLKLIRERKY KVLANQIDTS KKKVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-16159159Myocyte-specific enhancer factor 2B
1tqe_Q2e-16159159Myocyte-specific enhancer factor 2B
1tqe_R2e-16159159Myocyte-specific enhancer factor 2B
1tqe_S2e-16159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083640.15e-93PREDICTED: floral homeotic protein DEFICIENS-like
SwissprotP237065e-96DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLS8DEG01e-111S8DEG0_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc04g081000.2.12e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-74MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]